UQCRB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1273S
Article Name: UQCRB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1273S
Supplier Catalog Number: CNA1273S
Alternative Catalog Number: MBL-CNA1273S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human UQCRB (NP_006285.1).
Conjugation: Unconjugated
Alternative Names: QPC, QCR7, QP-C, UQBC, UQBP, UQPC, UQCR6, MC3DN3
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 7381
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Target: UQCRB
Application Dilute: WB: WB,1:1000 - 1:2000