COPS8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12745T
Article Name: COPS8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12745T
Supplier Catalog Number: CNA12745T
Alternative Catalog Number: MBL-CNA12745T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-209 of human COPS8 (NP_006701.1).
Conjugation: Unconjugated
Alternative Names: COP9, CSN8, SGN8
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 10920
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Target: COPS8
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200