RAB14 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12752P
Article Name: |
RAB14 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA12752P |
Supplier Catalog Number: |
CNA12752P |
Alternative Catalog Number: |
MBL-CNA12752P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human RAB14 (NP_057406.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
FBP, RAB-14 |
Clonality: |
Polyclonal |
Molecular Weight: |
24kDa |
NCBI: |
51552 |
Buffer: |
PBS with 0.05% proclin300,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,50% glycerol |
Sequence: |
TRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLF |
Target: |
RAB14 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |