Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12756P
Article Name: Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12756P
Supplier Catalog Number: CNA12756P
Alternative Catalog Number: MBL-CNA12756P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2).
Conjugation: Unconjugated
Alternative Names: TYH, DYT14, DYT5b
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 7054
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Target: TH
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200