NUP35 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12762T
Article Name: NUP35 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12762T
Supplier Catalog Number: CNA12762T
Alternative Catalog Number: MBL-CNA12762T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human NUP35 (NP_612142.2).
Conjugation: Unconjugated
Alternative Names: MP44, NP44, MP-44, NUP53
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 129401
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMESSDR
Target: NUP35
Application Dilute: WB: WB,1:500 - 1:2000