PEBP1 Rabbit mAb, Clone: [ARC0704], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12768S
Article Name: PEBP1 Rabbit mAb, Clone: [ARC0704], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12768S
Supplier Catalog Number: CNA12768S
Alternative Catalog Number: MBL-CNA12768S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086).
Conjugation: Unconjugated
Alternative Names: PBP, HCNP, PEBP, RKIP, HCNPpp, PEBP-1, HEL-210, HEL-S-34, HEL-S-96
Clonality: Monoclonal
Clone Designation: [ARC0704]
Molecular Weight: 21kDa
NCBI: 5037
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG
Target: PEBP1
Application Dilute: WB: WB,1:500 - 1:2000