ADIPOR2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12777P
Article Name: ADIPOR2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12777P
Supplier Catalog Number: CNA12777P
Alternative Catalog Number: MBL-CNA12777P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ADIPOR2 (NP_078827.2).
Conjugation: Unconjugated
Alternative Names: PAQR2, ACDCR2
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 79602
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Target: ADIPOR2
Application Dilute: WB: WB,1:100 - 1:500