PDIA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12789T
Article Name: PDIA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12789T
Supplier Catalog Number: CNA12789T
Alternative Catalog Number: MBL-CNA12789T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 326-525 of human PDIA2 (NP_006840.2).
Conjugation: Unconjugated
Alternative Names: PDI, PDA2, PDIP, PDIR
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 64714
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: FGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL
Target: PDIA2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200