SP3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12790T
Article Name: SP3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12790T
Supplier Catalog Number: CNA12790T
Alternative Catalog Number: MBL-CNA12790T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 705-781 of human SP3 (NP_003102.1).
Conjugation: Unconjugated
Alternative Names: SPR2
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 6670
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQLVTVSGNETME
Target: SP3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200