NOS1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12795S
Article Name: NOS1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12795S
Supplier Catalog Number: CNA12795S
Alternative Catalog Number: MBL-CNA12795S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NOS1 (NP_000611.1).
Conjugation: Unconjugated
Alternative Names: NOS, bNOS, nNOS, IHPS1, N-NOS, NC-NOS
Clonality: Polyclonal
Molecular Weight: 161kDa
NCBI: 4842
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
Target: NOS1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:20 - 1:50