ACTN3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12797T
Article Name: ACTN3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12797T
Supplier Catalog Number: CNA12797T
Alternative Catalog Number: MBL-CNA12797T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2).
Conjugation: Unconjugated
Alternative Names: ACTN3D
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 89
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ
Target: ACTN3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500