ITIH4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12807T
Article Name: ITIH4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12807T
Supplier Catalog Number: CNA12807T
Alternative Catalog Number: MBL-CNA12807T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 689-930 of human ITIH4 (NP_002209.2).
Conjugation: Unconjugated
Alternative Names: H4P, IHRP, GP120, PK120, ITIHL1, PK-120, ITI-HC4
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 3700
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Target: ITIH4
Application Dilute: WB: WB,1:500 - 1:2000