MRPL42 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12811T
Article Name: |
MRPL42 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA12811T |
Supplier Catalog Number: |
CNA12811T |
Alternative Catalog Number: |
MBL-CNA12811T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human MRPL42 (NP_054769.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
L31MT, L42MT, S32MT, MRPL31, MRPS32, PTD007, RPML31, HSPC204, MRP-L31, MRP-L42, MRP-S32 |
Clonality: |
Polyclonal |
Molecular Weight: |
17kDa |
NCBI: |
28977 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR |
Target: |
MRPL42 |
Application Dilute: |
WB: WB,1:1000 - 1:2000 |