Olig2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12814T
Article Name: Olig2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12814T
Supplier Catalog Number: CNA12814T
Alternative Catalog Number: MBL-CNA12814T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Olig2 (NP_005797.1).
Conjugation: Unconjugated
Alternative Names: BHLHB1, OLIGO2, RACK17, PRKCBP2, bHLHe19
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 10215
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQ
Target: OLIG2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100