PARP10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12815T
Article Name: PARP10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12815T
Supplier Catalog Number: CNA12815T
Alternative Catalog Number: MBL-CNA12815T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PARP10 (NP_116178.2).
Conjugation: Unconjugated
Alternative Names: ARTD10
Clonality: Polyclonal
Molecular Weight: 110kDa
NCBI: 84875
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPADAERVLAQADHELHGAQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPVQPCCALASPRPDRALVQLPKPLSEADVRVLEEQAQNLGLEGTLVSLARVPQARAVRVVGDGASVDLLLLELYLENERRSGGGPLEDLQRLPGPLGTVASFQQWQVAERVLQQEHRLQGSELSLVPHYDILEPEE
Target: PARP10
Application Dilute: WB: WB,1:500 - 1:2000