CDK11B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12830T
Article Name: CDK11B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12830T
Supplier Catalog Number: CNA12830T
Alternative Catalog Number: MBL-CNA12830T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CDK11B (NP_277021.2).
Conjugation: Unconjugated
Alternative Names: p58, PK58, CDK11, CLK-1, CDC2L1, PITSLREA, p58CLK-1, CDK11-p46, CDK11-p58, p58CDC2L1, CDK11-p110
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 984
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKERE
Target: CDK11B
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200