SLC7A9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12848T
Article Name: SLC7A9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12848T
Supplier Catalog Number: CNA12848T
Alternative Catalog Number: MBL-CNA12848T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1).
Conjugation: Unconjugated
Alternative Names: BAT1, CSNU3
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 11136
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL
Target: SLC7A9
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200