SULT1A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12851T
Article Name: SULT1A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12851T
Supplier Catalog Number: CNA12851T
Alternative Catalog Number: MBL-CNA12851T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human SULT1A2 (NP_001045.1).
Conjugation: Unconjugated
Alternative Names: STP2, HAST4, P-PST, ST1A2, TSPST2, P-PST 2
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 6799
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Target: SULT1A2
Application Dilute: WB: WB,1:500 - 1:2000