TP53I11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12855T
Article Name: TP53I11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12855T
Supplier Catalog Number: CNA12855T
Alternative Catalog Number: MBL-CNA12855T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TP53I11 (NP_001245249.1).
Conjugation: Unconjugated
Alternative Names: PIG11
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 9537
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA
Target: TP53I11
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100