HLA-B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1285T
Article Name: HLA-B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1285T
Supplier Catalog Number: CNA1285T
Alternative Catalog Number: MBL-CNA1285T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-B (NP_005505.2).
Conjugation: Unconjugated
Alternative Names: AS, HLAB, B-4901
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 3106
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
Target: HLA-B
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200