SLC17A7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12879P
Article Name: SLC17A7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12879P
Supplier Catalog Number: CNA12879P
Alternative Catalog Number: MBL-CNA12879P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP_064705.1).
Conjugation: Unconjugated
Alternative Names: BNPI, VGLUT1
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 57030
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY
Target: SLC17A7
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200