CLN5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12886T
Article Name: CLN5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12886T
Supplier Catalog Number: CNA12886T
Alternative Catalog Number: MBL-CNA12886T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 96-407 of human CLN5 (NP_006484.1).
Conjugation: Unconjugated
Alternative Names: CLN5,NCL
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 1203
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLP
Target: CLN5
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200