FCER1G Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12889T
Article Name: FCER1G Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12889T
Supplier Catalog Number: CNA12889T
Alternative Catalog Number: MBL-CNA12889T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1).
Conjugation: Unconjugated
Alternative Names: FCRG
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 2207
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Target: FCER1G
Application Dilute: WB: WB,1:1000 - 1:2000