Secretagogin (SCGN) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12897T
Article Name: Secretagogin (SCGN) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12897T
Supplier Catalog Number: CNA12897T
Alternative Catalog Number: MBL-CNA12897T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-276 of human Secretagogin (Secretagogin (SCGN)) (NP_008929.2).
Conjugation: Unconjugated
Alternative Names: SEGN, CALBL, SECRET, setagin, DJ501N12.8
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 10590
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCD
Target: SCGN
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200