Clusterin alpha chain Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12913T
Article Name: Clusterin alpha chain Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12913T
Supplier Catalog Number: CNA12913T
Alternative Catalog Number: MBL-CNA12913T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3).
Conjugation: Unconjugated
Alternative Names: CLI, AAG4, APOJ, CLU1, CLU2, KUB1, SGP2, APO-J, SGP-2, SP-40, TRPM2, TRPM-2, NA1/NA2
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 1191
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: STNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Target: CLU
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200