DKC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12914T
Article Name: DKC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12914T
Supplier Catalog Number: CNA12914T
Alternative Catalog Number: MBL-CNA12914T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human DKC1 (NP_001354.1).
Conjugation: Unconjugated
Alternative Names: DKC, CBF5, DKCX, NAP57, NOLA4, XAP101
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 1736
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGAL
Target: DKC1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100