YY1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12928T
Article Name: YY1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12928T
Supplier Catalog Number: CNA12928T
Alternative Catalog Number: MBL-CNA12928T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human YY1 (NP_003394.1).
Conjugation: Unconjugated
Alternative Names: DELTA, NF-E1, UCRBP, GADEVS, INO80S, YIN-YANG-1
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 7528
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSG
Target: YY1
Application Dilute: WB: WB,1:500 - 1:1000|ChIP,1:50 - 1:200