VAPA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12939T
Article Name: VAPA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12939T
Supplier Catalog Number: CNA12939T
Alternative Catalog Number: MBL-CNA12939T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 137-227 of human VAPA (NP_919415.2).
Conjugation: Unconjugated
Alternative Names: VAP-A, VAP33, VAMP-A, VAP-33, hVAP-33
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 9218
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSP
Target: VAPA
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200