ATP6V1D Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12940T
Article Name: ATP6V1D Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12940T
Supplier Catalog Number: CNA12940T
Alternative Catalog Number: MBL-CNA12940T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-247 of human ATP6V1D (NP_057078.1).
Conjugation: Unconjugated
Alternative Names: VATD, VMA8, ATP6M
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 51382
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
Target: ATP6V1D
Application Dilute: WB: WB,1:500 - 1:2000