[KO Validated] CDK7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12942T
Article Name: [KO Validated] CDK7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12942T
Supplier Catalog Number: CNA12942T
Alternative Catalog Number: MBL-CNA12942T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1).
Conjugation: Unconjugated
Alternative Names: CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 1022
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Target: CDK7
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200