PGK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12952T
Article Name: PGK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12952T
Supplier Catalog Number: CNA12952T
Alternative Catalog Number: MBL-CNA12952T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 242-360 of human PGK2 (NP_620061.2).
Conjugation: Unconjugated
Alternative Names: PGKB, PGKPS, HEL-S-272, dJ417L20.2
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 5232
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
Target: PGK2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100