p63 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12960T
| Article Name: |
p63 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA12960T |
| Supplier Catalog Number: |
CNA12960T |
| Alternative Catalog Number: |
MBL-CNA12960T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human p63 (NP_003713.3). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
AIS, KET, LMS, NBP, RHS, p40, p51, p63, EEC3, OFC8, p73H, p73L, SHFM4, TP53L, TP73L, p53CP, TP53CP, B(p51A), B(p51B) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
77kDa |
| NCBI: |
8626 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALS |
| Target: |
TP63 |
| Application Dilute: |
WB: WB,1:1000 - 1:2000 |
