MARCH8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12962T
Article Name: MARCH8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12962T
Supplier Catalog Number: CNA12962T
Alternative Catalog Number: MBL-CNA12962T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 232-291 of human MARCH8 (NP_659458.2).
Conjugation: Unconjugated
Alternative Names: MIR, CMIR, c-MIR, MARCH8, RNF178, MARCH-VIII
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 220972
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV
Target: MARCHF8
Application Dilute: WB: WB,1:500 - 1:2000