PITPNA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12966T
Article Name: PITPNA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12966T
Supplier Catalog Number: CNA12966T
Alternative Catalog Number: MBL-CNA12966T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 211-270 of human PITPNA (NP_006215.1).
Conjugation: Unconjugated
Alternative Names: PITPN, VIB1A, HEL-S-36, PI-TPalpha
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 5306
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Target: PITPNA
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200