p63 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12968T
Article Name: |
p63 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA12968T |
Supplier Catalog Number: |
CNA12968T |
Alternative Catalog Number: |
MBL-CNA12968T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human p63 (NP_003713.3). |
Conjugation: |
Unconjugated |
Alternative Names: |
AIS, KET, LMS, NBP, RHS, p40, p51, p63, EEC3, OFC8, p73H, p73L, SHFM4, TP53L, TP73L, p53CP, TP53CP, B(p51A), B(p51B) |
Clonality: |
Polyclonal |
Molecular Weight: |
77kDa |
NCBI: |
8626 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALS |
Target: |
TP63 |
Application Dilute: |
WB: WB,1:1000 - 1:2000 |