WIF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12969S
Article Name: WIF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12969S
Supplier Catalog Number: CNA12969S
Alternative Catalog Number: MBL-CNA12969S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-220 of human WIF1 (NP_009122.2).
Conjugation: Unconjugated
Alternative Names: WIF-1
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 11197
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMN
Target: WIF1
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200