SLC12A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12999T
Article Name: SLC12A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12999T
Supplier Catalog Number: CNA12999T
Alternative Catalog Number: MBL-CNA12999T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SLC12A1 (NP_000329.2).
Conjugation: Unconjugated
Alternative Names: BSC, BSC1, CCC2, BSC-1, NKCC2
Clonality: Polyclonal
Molecular Weight: 121kDa
NCBI: 6557
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: FGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSAD
Target: SLC12A1
Application Dilute: WB: WB,1:500 - 1:2000