CYP2D6 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1299S
Article Name: |
CYP2D6 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA1299S |
Supplier Catalog Number: |
CNA1299S |
Alternative Catalog Number: |
MBL-CNA1299S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 20-230 of human CYP2D6 (NP_000097.3). |
Conjugation: |
Unconjugated |
Alternative Names: |
CPD6, CYP2D, CYP2DL1, CYPIID6, P450C2D, P450DB1, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, P450-DB1 |
Clonality: |
Polyclonal |
Molecular Weight: |
56kDa |
NCBI: |
1565 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
VDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVL |
Target: |
CYP2D6 |
Application Dilute: |
WB: WB,1:100 - 1:500 |