AKR1C1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13004T
Article Name: AKR1C1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13004T
Supplier Catalog Number: CNA13004T
Alternative Catalog Number: MBL-CNA13004T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C1 (NP_001344.2).
Conjugation: Unconjugated
Alternative Names: C9, DD1, DDH, DDH1, H-37, HBAB, MBAB, HAKRC, DD1/DD2, 2-ALPHA-HSD, 20-ALPHA-HSD
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 1645
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL
Target: AKR1C1
Application Dilute: WB: WB,1:1000 - 1:3000