HDAC7 Rabbit mAb, Clone: [ARC0713], Unconjugated, Monoclonal

Catalog Number: MBL-CNA13008S
Article Name: HDAC7 Rabbit mAb, Clone: [ARC0713], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA13008S
Supplier Catalog Number: CNA13008S
Alternative Catalog Number: MBL-CNA13008S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-198 of human HDAC7 (Q8WUI4).
Conjugation: Unconjugated
Alternative Names: HD7, HD7A, HDAC7A
Clonality: Monoclonal
Clone Designation: [ARC0713]
Molecular Weight: 103kDa
NCBI: 51564
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSS
Target: HDAC7
Application Dilute: WB: WB,1:500 - 1:1000