CEL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13011T
Article Name: CEL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13011T
Supplier Catalog Number: CNA13011T
Alternative Catalog Number: MBL-CNA13011T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-550 of human CEL (NP_001798.2).
Conjugation: Unconjugated
Alternative Names: BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 1056
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYL
Target: CEL
Application Dilute: WB: WB,1:500 - 1:2000