Neutrophil Elastase (ELANE) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13015P
Article Name: Neutrophil Elastase (ELANE) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13015P
Supplier Catalog Number: CNA13015P
Alternative Catalog Number: MBL-CNA13015P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 168-267 of human Neutrophil Elastase (ELANE) (NP_001963.1).
Conjugation: Unconjugated
Alternative Names: GE, NE, HLE, HNE, ELA2, SCN1, PMN-E
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 1991
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Target: ELANE
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200