OVGP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13036T
Article Name: OVGP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13036T
Supplier Catalog Number: CNA13036T
Alternative Catalog Number: MBL-CNA13036T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-260 of human OVGP1 (NP_002548.3).
Conjugation: Unconjugated
Alternative Names: EGP, OGP, MUC9, CHIT5
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 5016
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKDLQDEKILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKFIASVISLLRTHDFDGLDLFFLYPGLRGSPMHDRWTFLFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINVLSYDLHGSWERFTGHNSPLFSLPEDPKSSAYAMNYWRKLGAPSEKLIMGI
Target: OVGP1
Application Dilute: WB: WB,1:500 - 1:2000