CXCR4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1303S
Article Name: CXCR4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1303S
Supplier Catalog Number: CNA1303S
Alternative Catalog Number: MBL-CNA1303S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CXCR4 (NP_003458.1).
Conjugation: Unconjugated
Alternative Names: FB22, HM89, LAP3, LCR1, NPYR, WHIM, CD184, LAP-3, LESTR, NPY3R, NPYRL, WHIMS, HSY3RR, NPYY3R, WHIMS1, D2S201E
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 7852
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVA
Target: CXCR4
Application Dilute: WB: WB,1:500 - 1:1000