PROX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13042T
Article Name: PROX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13042T
Supplier Catalog Number: CNA13042T
Alternative Catalog Number: MBL-CNA13042T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-375 of human PROX1 (NP_002754.2).
Conjugation: Unconjugated
Alternative Names: PROX1
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 5629
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SFQQLVSARKEQKREERRQLKQQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMRSEILDARAQDSVGRSDNEMCELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETLKQELNTAMSQVVDTVVKVFSAKP
Target: PROX1
Application Dilute: WB: WB,1:500 - 1:1000