SREBP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13049S1
Article Name: SREBP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13049S1
Supplier Catalog Number: CNA13049S1
Alternative Catalog Number: MBL-CNA13049S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 155-310 of human SREBF2 (NP_004590.2).
Conjugation: Unconjugated
Alternative Names: SREBP2, bHLHd2, SREBP-2
Clonality: Polyclonal
Molecular Weight: 124kDa
NCBI: 6721
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: TFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILTTMPVMMGQEK
Target: SREBF2
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200