TBCA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13050T
Article Name: TBCA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13050T
Supplier Catalog Number: CNA13050T
Alternative Catalog Number: MBL-CNA13050T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TBCA (NP_004598.1).
Conjugation: Unconjugated
Alternative Names: TBCA
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 6902
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Target: TBCA
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200