UPP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13051T
Article Name: UPP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13051T
Supplier Catalog Number: CNA13051T
Alternative Catalog Number: MBL-CNA13051T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 89-173 of human UPP1 (NP_001274357.1).
Conjugation: Unconjugated
Alternative Names: UP, UPP, UPASE, UDRPASE
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 7378
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA
Target: UPP1
Application Dilute: WB: WB,1:1000 - 1:2000