Xanthine Oxidase (XDH) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13052P
Article Name: Xanthine Oxidase (XDH) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13052P
Supplier Catalog Number: CNA13052P
Alternative Catalog Number: MBL-CNA13052P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Xanthine Oxidase (XDH) (NP_000370.2).
Conjugation: Unconjugated
Alternative Names: XO, XOR, XAN1
Clonality: Polyclonal
Molecular Weight: 146kDa
NCBI: 7498
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: CIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILK
Target: XDH
Application Dilute: WB: WB,1:500 - 1:1000