ITGA8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13056T
Article Name: ITGA8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13056T
Supplier Catalog Number: CNA13056T
Alternative Catalog Number: MBL-CNA13056T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 907-1000 of human ITGA8 (NP_003629.2).
Conjugation: Unconjugated
Alternative Names: ITGA8
Clonality: Polyclonal
Molecular Weight: 117kDa
NCBI: 8516
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALASLVSFEVKKMPYTDQPAKLPEGSIVIKTSVI
Target: ITGA8
Application Dilute: WB: WB,1:500 - 1:2000